HORDB

ID: hor006345
Uniprot ID: Q9W0W6
Protein name: NPLP1-3
Gene name: Nplp1
Organism: Drosophila melanogaster (Fruit fly)
Family: NA
Source: animal
Expression: MTYamide peptide: Expressed in the larval CNS (at protein level). NAP peptide: Expressed in the larval CNS (at protein level). IPNamide peptide: Expressed in the ventral ganglion of the third larval instar and adult brain (at protein level).
Disease: NA
Comments: NA
Taxonomy: melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005184 neuropeptide hormone activity; GO:0048018 receptor ligand activity
GO BP: GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: NVAAVARYNSQHGHIQRAGAE
Length: 21(206-226)
Propeptide: MQAVLQSAHSSRRLMLLLSMLLNAAIQPRSIIVSATDDVANVSPCEMESLINQLMSPSPEYQLHASALRNQLKNLLRERQLAVGEEQPLGEYPDYLEEDKRSVAALAAQGLLNAPKRSLATLAKNGQLPTAEPGEDYGDADSGEPSEQKRYIGSLARAGGLMTYGKRNVGTLARDFQLPIPNGKRNIATMARLQSAPSTHRDPKRNVAAVARYNSQHGHIQRAGAEKRNLGALKSSPVHGVQQKREDEEMLLPAA
Signal peptide: MQAVLQSAHSSRRLMLLLSMLLNAAIQP
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: [NPLP1-4]: Acts as a ligand for the receptor-type guanylate cyclase Gyc76C (PubMed:21893139). Stimulates Gyc76c-dependent cGMP production and modulates the IMD innate immune pathway in response to salt stress by inducing nuclear translocation of NF-kappa-
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006345_AF2.pdb

hor006345_ESM.pdb

Mass:	260637	Formula:	C94H149N35O30
Absent amino acids:	CDFKLMPTW	Common amino acids:	A
pI:	9.35	Basic residues:	4
Polar residues:	6	Hydrophobic residues:	8
Hydrophobicity:	-66.19	Boman Index:	-4994
Half-Life:	1.4 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	70
Instability Index:	2661.9	Extinction Coefficient cystines:	1490
Absorbance 280nm:	74.5

PubMed ID: 10731132
Title: The genome sequence of Drosophila melanogaster.
PubMed ID: 12537572
Title: Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
PubMed ID: 12537569
Title: A Drosophila full-length cDNA resource.
PubMed ID: 12171930
Title: Peptidomics of the larval Drosophila melanogaster central nervous system.
PubMed ID: 14690519
Title: Expres
PubMed ID: 21893139
Title:
PubMed ID: 26440503
Title: